Introducci - PowerPoint PPT Presentation

Loading...

PPT – Introducci PowerPoint presentation | free to download - id: 7c4f32-MmViM



Loading


The Adobe Flash plugin is needed to view this content

Get the plugin now

View by Category
About This Presentation
Title:

Introducci

Description:

Title: Tema 1: Introducci n a la Biocomputaci n Author: Antonio Barbadilla Last modified by: Usuari UAB Created Date: 1/28/1998 12:20:38 PM Document presentation format – PowerPoint PPT presentation

Number of Views:6
Avg rating:3.0/5.0
Slides: 48
Provided by: Antoni364
Learn more at: http://bioinformatica.uab.es
Category:

less

Write a Comment
User Comments (0)
Transcript and Presenter's Notes

Title: Introducci


1
Introducció a la Bioinformàtica
  • Bioinformàtica la recerca biomèdica in silico

2
Proteómica
3
Proteómica Introducción
Proteómica Estudio de los proteomas Proteomas
Proteinas codificadas por un genoma
diferentes proteomas
1 genoma
30.000 Proteïnas/celula
30.000 genes/genoma
300.000 Proteïnas/genoma
4
Proteómica Introducción
Proteomas Separacion, identificación y
caraterización de las proteínas presentes en una
muestra biologica
  • Estado metabólico
  • Momento del desarrollo
  • Niveles de expresión
  • Modificaciones postranscripcionales
  • Localización celular
  • Activación por señales externas

5
Proteómica Objetivos
Objetivos
  • Comparar proteomas distintos
  • Identificar una proteína desconocida
  • Identificar interacciones entre proteínas
  • Predicción estructura secundaria
  • Determinar presencia de motivos
  • Predicción estructura terciaria
  • Determinar función de la proteína

6
Proteómica Bases de datos especificos de
proteínas
7
Prot Prim
Bancos especializados de proteínas
Bases de secuencia de proteínas
  • Swiss-Prot
  • PIR
  • Protein
  • International
  • Resource
  • Proteomas

8
Bancos especializados de proteínas
9
PIR
Bancos especializados de proteínas
Entrada PIR
10
Proteómica Introducción
Proteomas www.ebi.ac.uk/proteome
11
Prot Secun
Bancos especializados de proteínas
Bases de datos especializados de proteínas
  • Prosite (Patrones)
  • interpro, iproclass (dominios/clasificación)
  • Protein Data Bank PDB Protein Data Bank
    (estructura)
  • DIP (base de datos de interacciones entre
    proteínas)
  • Swiss 2D-page (mapas bidimensionales)
  • BRENDA (enzimas)
  • PharmGKB (dianas terapeuticas)
  • Therapeutic Target Database (dianas terapeuticas)

12
Bancos especializados de proteínas
http//us.expasy.org/prosite/
13
Bancos especializados de proteínas
www.ebi.ac.uk/interpro
14
Bancos especializados de proteínas
15
Identificar interacciones entre proteínas
http//dip.doe-mbi.ucla.edu/dip/Search.cgi
16
Bancos especializados de proteínas
http//us.expasy.org
17
Bancos especializados de proteínas
18
Bancos especializados de proteínas
19
Bancos especializados de proteínas
20
Bancos especializados de proteínas
21
Bancos especializados de proteínas
22
Exemples
1-La estructura del domino globular de la
histona H5 (1Hst) se ha resuelto por
cristalografía. Quieres estudiar la estabilidad
de la primera hélice utilizando un péptido que
incluya dicha hélice, cual es la secuencia de
dicho péptido? 2- Quieres realizar un estudio de
los niveles de histona mediante geles
bidimensionales. Que tejidos podrás usar como
referencia de su nivel? 3- Cuales de estas
proteinas se pueden usar como diana terapeutica
de la diabetes (Diabetes mellitus) ? a) Acyl-CoA
desaturase 1   b) 3-phosphoinositide dependent
protein kinase-1     c) Endothelin receptor d)
Todas ellas 4- Cuáles de las anteriores
coresponden a un enzima y cual es su EC-number?
 
23
5- Estas realizando un estudio comparativo de
extractos proteicos de riñón mediante geles
bidimensionales entre ratas control y ratas con
insuficiencia renal. Ves modificaciones en la
intensidad del spot marcado con una flecha de
que proteína se trata? 6-busca los posibles
lugares de fosforilación de la histona h10 humana
por la ck2.
24
Proteómica Objetivos
Objetivos
  • Comparar proteomas distintos
  • Identificar una proteína desconocida
  • Identificar interacciones entre proteínas
  • Predicción estructura secundaria
  • Determinar presencia de motivos
  • Predicción estructura terciaria
  • Determinar función de la proteína

25
Proteómica Comparar proteomas distintos
26
Comparar proteomas distintos
http//ural.wustl.edu/billy/Procom/
27
Proteómica Identificación de proteínas
28
Comparar proteomas distintos
http//us.expasy.org
29
Identificar una proteína desconocida
  • Identificar una proteína desconocida

Tecnicas experimentales -Secuenciación de
novo de péptidos -Microchips de proteínas
-MALDI-TOF -geles bidimensionales
combinadas con la bioinformatica
30
Identificar una proteína desconocida
31
Identificar una proteína desconocida
Identificación de una proteína a partir de sus
características fisicoquímicas y a partir de una
digestión enzimática
  • Analysis Whole Protein  
  • Molecular Weight 55746.95 m.w.  
  • Length 501  
  • Isoelectric Point 5.40  
  • Charge at pH 7 -11.54  

32
Identificar una proteína desconocida
  • N. count by weight by
    frequency
  • Acidic (DE) 55 12.06 10.98  
  • Basic (KR) 42 10.96 8.38  
  • Polar (NCQSTY) 129 26.13 25.75  
  • Hydrophobic (AILFWV) 180 35.64 35.93  
  • N. count by weight by
    frequency
  • A Ala 35 4.46 6.99  
  • C Cys 11 2.04 2.20  
  • D Asp 27 5.57 5.39  
  • E Glu 28 6.49 5.59  
  • F Phe 22 5.81 4.39  
  • G Gly 42 4.30 8.38  
  • H His 11 2.71 2.20  
  • I Ile 29 5.89 5.79  
  • K Lys 16 3.68 3.19  
  • L Leu 48 9.74 9.58  
  • M Met 14 3.29 2.79  
  • N Asn 15 3.07 2.99  
  • N. count by weight by
    frequency
  • R Arg 26 7.28 5.19  
  • S Ser 34 5.31 6.79  
  • T Thr 29 5.26 5.79  
  • V Val 36 6.40 7.19  
  • W Trp 10 3.34 2.00  
  • Y Tyr 20 5.85 3.99  
  • B Asx 0 0.00 0.00  
  • Z Glx 0 0.00 0.00  
  • X Xxx 0 0.00 0.00  
  • . Ter 0 0.00 0.00

33
Identificar una proteína desconocida
Digestión enzimática
  • Hydroxylamine - 4 cuts
  • Position Length Weight pI 1/2 life HPLC
    rt Fragment
  • 1 66 7185.32 5.64 gt20h 81.24 MAPALHWLL...GSFVEMVDN
  • 67 106 11717.18 9.10 3m 85.54 LRGKSGQGY...TESDKFFI
    N
  • 173 98 10902.40 4.46 gt20h 88.02 GSNWEGILG...VIIVRV
    EIN
  • 271 24 2723.94 4.13 gt20h 57.76 GQDLKMDCK...SIVDSGT
    TN
  • 295 207 23286.10 5.34 3m 96.18 LRLPKKVFE...FADDISL
    LK

34
Identificar una proteína desconocida
Digestión enzimática
35
Identificar una proteína desconocida
  • http//us.expasy.org/tools/proteome

36
Identificar una proteína desconocida
37
Identificar una proteína desconocida
38
Identificar una proteína desconocida
Proteína problema (obtenida directamente del
banco de datos)
MRVLLVALALLALAASATSTHTSGGCGCQPPPPVHLPPPVHLPPPVHLPP
PVHLPPPVHLPPPVHLPPPVHVPPPVHLPPPPCHYPTQPPRPQPHPQPHP
CPCQQPHPSPCQLQGTCGVGSTPILGQCVEFLRHQCSPTATPYCSPQCQS
LRQQCCQQLRQVEPQHRYQAIFGLVLQSILQQQPQSGQVAGLLAAQIAQQ
LTAMCGLQQPTPCPYAAAGGVPH
Purificada de maiz (Zea mays) Pm ? pI
? Composicio de aa ? Masa molecular de los
peptidos por digestión con tripsina ?
39
Identificar una proteína desconocida
40
Identificar una proteína desconocida
41
Identificar una proteína desconocida
42
Identificar una proteína desconocida
43
Identificar una proteína desconocida
PROTEINA PROBLEMA Purificada de maiz (Zea
mays) Pm 23688.6 pI 8.40 Composicio de aa
Ala (A) 16 7.2 Arg (R) 6 2.7 Asn (N) 0 0.0
Asp (D) 0 0.0 Cys (C) 15 6.7 Gln (Q) 30
13.5 Glu (E) 2 0.9 Gly (G) 13 5.8 His (H) 16
7.2 Ile (I) 4 1.8 Leu (L) 25 11.2 Lys (K) 0
0.0 Met (M) 2 0.9 Phe (F) 2 0.9 Pro (P) 51
22.9 Ser (S) 10 4.5 Thr (T) 10 4.5 Trp (W) 0
0.0 Tyr (Y) 4 1.8 Val (V) 17 7.6 Masa
molecular de los peptidos por digestión con
tripsina 305.4 13690.2 2107.4 1006.2 892.9
5776.7
44
Proteómica Identificación de interacciones
45
Identificar interacciones entre proteínas
Interacciones descritas en el proteoma de levadura
46
Identificar interacciones entre proteínas
http//dip.doe-mbi.ucla.edu/dip/Search.cgi
47
Identificar interacciones entre proteínas
About PowerShow.com