Support Vector Machine and String Kernels for Protein Classification - PowerPoint PPT Presentation

View by Category
About This Presentation
Title:

Support Vector Machine and String Kernels for Protein Classification

Description:

1A3N:A HEMOGLOBIN. VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK ... 1A3N:B HEMOGLOBIN. VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKV ... – PowerPoint PPT presentation

Number of Views:272
Avg rating:3.0/5.0
Slides: 37
Provided by: Christin462
Learn more at: http://www.cs.tau.ac.il
Category:

less

Write a Comment
User Comments (0)
Transcript and Presenter's Notes
About PowerShow.com