Title: Molecular Biology Databases
1Molecular Biology Databases
- NCBI, DDBL, EMBL and others
2What is a Database?
- A database can be defined as "a collection of
data arranged for ease and speed of search and
retrieval. - A DNA database contains individual records or
data entries of the DNA sequences as well as
information about the sequences. - A DNA database often contains flat-files. These
are relatively simple database systems in which
each database is contained in a single table. - In contrast, relational database systems can use
multiple tables to store information, and each
table can have a different record format.
3GenBank as a Database
- GenBank is the National Institute of Health (NIH)
genetic sequence database, an annotated
collection of all publicly available DNA
sequences. - It is maintained by the National Center for
Biotechnology Information (NCBI) within the
National Institute of Health (NIH).
4Anatomy of a Genome InfoSystem
- Information structure
- Records of hierarchical, complex documents
Tables of rows and columns of numbers, letters,
words - Table of contents, Reports, Indexing (as a
reference book) - Browse thru available structure.
- Search and retrieve according to biological
questions - Bulk data selection retrieval for other uses
- Information content
- Primary Literature (referenced, abstracted
and curated), Sequence and feature analyses,
maps, controlled vocabulary/ontologies relevant
to biology, people, research methods, contacts,
etc. - Metadata describing primary data, along with
protocols, notes, sources - Informatics / software
- Back-end database, data collection,
management, with some analyses - Front-end information services (hypertext
web, document search/retrieval methods) ease of
understanding and usage (HCI) - Middleware glue code, software, etc.
- Specialized application for genome data maps,
BLAST searches, ontologies
5History of Sequence Databases
- The first bioinformatics databases were
constructed a few years after the first protein
sequences began to become available. - The first protein sequence reported was that of
bovine insulin in 1956, consisting of 51
residues. - Nearly a decade later, the first nucleic acid
sequence was reported, that of yeast alanine tRNA
with 77 bases. - Just a year later, Dayhoff gathered all the
available sequence data to create the first
bioinformatic database. - The Protein DataBank followed in 1972 with a
collection of ten X-ray crystallographic protein
structures, and the SWISSPROT protein sequence
database began in 1987.
6GenBank History
- DNA databases began in the early 1980s with a
database called GenBank, which was originated by
the U.S. Department of Energy to hold the short
stretches of DNA sequence that scientists were
just beginning to obtain from a range of
organisms. - In the early days of GenBank, rooms of
technicians sat at keyboards consisting of only
the four letters A, C, T and G, tediously
entering the DNA-sequence information published
in academic journals.
7The National Center for Biotechnology Information
- Created as a part of NLM in 1988
- Establish public databases
- U.S. National DNA Sequence Database
- Perform research in computational biology
- Develop software tools for sequence analysis
- Disseminate biomedical information
8GenBank History
- Newer communication technologies enabled
researchers to dial up GenBank and dump in their
sequence data directly. - The administration of GenBank was transferred to
National Institutes of Health's National Center
for Biotechnology Information (NCBI). - With the advent of the World Wide Web,
researchers could access the data in GenBank for
free from around the globe. - Once the Human Genome Project (HGP) began in
1990, DNA-sequence data in GenBank began to grow
exponentially. - With the introduction in the 1990s of
high-throughput sequencing additions to GenBank
skyrocketed.
9- An Interesting Metaphor
- For Bioinformatics Information Flow and Databases
- Cooks generate and enter the data.
- Data Management makes it into a stew of blended
information. - The waiters take the data from the servers to the
public. - The diners are placing orders for the information
they wish to consume.
10(No Transcript)
11Molecular Databases
- Primary Databases
- Original submissions by experimentalists
- Database staff organize but dont add additional
information - Example GenBank,SNP, GEO
- Derivative Databases
- Human curated
- compilation and correction of data
- Example SWISS-PROT, NCBI RefSeq mRNA
- Computationally Derived
- Example UniGene
- Combinations
- Example NCBI Genome Assembly
12What, the scientists submit their own DNA
sequences?
- Who checks for error?
- Who makes people actually send their data to the
database so all can share it? - Learn from success, failure of GenBank/EMBL
extensive publicly shared bio-data - Carrot/stick approach. Granting agencies and
journals began requiring scientists to publish
sequence data. Patented sequences must be
entered in the databases too. - However, there is significant public databank
error due to data ownership by scientists no
inducements to update or go back and correct
errors.
13(No Transcript)
14GenBank is NCBIs Primary Sequence Database
- Nucleotide only sequence database
- Archival in nature
- GenBank Data
- Direct submissions (traditional records )
- Batch submissions (EST, GSS, STS)
- ftp accounts (genome data)
- Three collaborating databases
- GenBank
- DNA Database of Japan (DDBJ)
- European Molecular Biology Laboratory (EMBL)
Database
15Why use Bioinformatics Databases?
- Speed of information retrieval
- Increasing size of data sets
- Amount of information available
- Save time and money by simulating experiments
prior to actual experiment (a.k.a. in silico)
16How do you access Databases?
- Search engines
- Programs that allow you to search the database
- Links from other sites to the search engines
- Programs that directly link to the search engines
17Boolean Logic
- Why do we use Boolean operators
- To narrow your search
- get fewer superfluous results
- What are the Boolean Operators
- AND-looks for entries with both terms
- OR-looks for entries with one term or the other
- NOT (or BUTNOT)-looks for entries with one term
but not the other
- (Wildcard) -looks for ALL entries that contain
the term with the after it
18AND
Allergy
Food
Citations that contain the descriptors Food AND
Allergy only.
19OR
Citations that contain the descriptors Food OR
Allergy. This is a bigger set.
20NOT
Citations that contain the descriptors Allergy
NOT Food
21 (Wildcard)
Allerg
Food
Citations that contain the descriptors Allerg
(Allergies, Allergy, Allergen
22GenBank as a Database
- GenBank identifiers are unique combination of
numbers and letters used to index GenBank
sequence entries. - They can be used to retrieve information about a
particular gene or DNA sequence from the GenBank
database. - This information also includes links to similar
sequence entries and other public databases,
making it a relational database as well as a flat
file database.
23What is GenBank? NCBIs Primary Sequence Database
- Nucleotide only sequence database
- Archival in nature
- GenBank Data
- Direct submissions individual records (BankIt,
Sequin) - Batch submissions via email (EST, GSS, STS)
- ftp accounts sequencing centers
- Data shared three collaborating databases
- GenBank
- DNA Database of Japan (DDBJ).
- European Molecular Biology Laboratory Database
- (EMBL) at EBI.
24The International Sequence Database Collaboration
25GenBank NCBIs Primary Sequence Database
83.65 Gigabytes of data
26GenBank NCBIs Primary Sequence Database
114 Gigabytes
27GenBank NCBIs Primary Sequence Database
- full release every two months
- incremental and cumulative updates daily
- available only through internet
ftp//ftp.ncbi.nih.gov/genbank/
28The Growth of GenBank
Release 139 31.0 million records 36.6
billion nucleotides Average doubling time 12
months
Sequence Records (millions)
Total Base Pairs (billions)
29The Entrez System
30Entrez Nucleotides
- Primary
- GenBank / EMBL / DDBJ 35,116,960
- Derivative
- RefSeq 259,219
- Third Party Annotation 3,182
- PDB 4,703
-
- Total
35,384,248
31Entrez Protein
-
- GenPept (GB,EMBL, DDBJ) 3,442,298
- RefSeq 856,191
- Third Party Annotation 3,834
- Swiss Prot 144,508
- PIR 282,821
- PRF
12,079 -
- Total
3,442,298 - BLAST nr
1,642,191
32Organization of GenBankGenBank Divisions
- Records are divided into 17 Divisions.
- 1 Patent (11 files)
- 5 High Throughput
- 11 Traditional
EST (288) Expressed Sequence Tag GSS (98)
Genome Survey Sequence HTG (61) High Throughput
Genomic STS (3) Sequence Tagged Site HTC (3)
High Throughput cDNA
PRI (27) Primate PLN (10) Plant and
Fungal BCT (8) Bacterial and Archeal INV
(6) Invertebrate ROD (11) Rodent VRL (3)
Viral VRT (4) Other Vertebrate MAM (1)
Mammalian (ex. ROD and PRI) PHG (1) Phage SYN
(1) Synthetic (cloning vectors) UNA (1)
Unannotated
- Traditional Divisions
- Direct Submissions
- (Sequin and BankIt)
- Accurate
- Well characterized
- BULK Divisions
- Batch Submission
- (Email and FTP)
- Inaccurate
- Poorly characterized
Entrez query gbdiv_xxxProperties
33Traditional GenBank Divisions
- Direct Submissions (Sequin and BankIt)
- Accurate
- Well characterized
BCT Bacterial and Archeal INV Invertebrate MAM Ma
mmalian (ex. ROD and PRI) PHG Phage PLN Plant and
Fungal PRI Primate ROD Rodent SYN Synthetic
(cloning vectors) VRL Viral VRT Other Vertebrate
34A Helpful Resource
- This is a link to a sample annotated GenBank
Record. Click on any of the underlined links to
learn more about the file structure. - http//www.ncbi.nlm.nih.gov/Sitemap/samplerecord.h
tml
35What is an Accession Number?
- An accession number is label that used to
identify a sequence in the various databases. It
is a string of letters and/or numbers that
corresponds to a molecular sequence. - Examples (all for retinol-binding protein, RBP4)
- X02775 GenBank genomic DNA sequence
- NT_030059 Genomic contig
- Rs7079946 dbSNP (single nucleotide polymorphism)
- N91759.1 An expressed sequence tag (1 of 170)
- NM_006744 RefSeq DNA sequence (from a transcript)
- NP_007635 RefSeq protein
- AAC02945 GenBank protein
- Q28369 SwissProt protein
- 1KT7 Protein Data Bank structure record
36GenBank Flat File Format
- When you click on an entry, you have opened a
GenBank Flat File - Information includes
- The Name of the gene
- The Accession number
- Journal articles
37GenBank Flat File Format
- Information (Cont)
- Structural information of the gene (eg
intron/exon boundaries, promoters,etc) - The code for the protein
- The code for the DNA (RNA-if mRNA it is the cDNA
for the mRNA sequenced)
38A Traditional GenBank Record
LOCUS AF062069 3808 bp mRNA
INV 02-MAR-2000 DEFINITION Limulus
polyphemus myosin III mRNA, complete
cds. ACCESSION AF062069 VERSION AF062069.2
GI7144484 KEYWORDS . SOURCE Atlantic
horseshoe crab. ORGANISM Limulus polyphemus
Eukaryota Metazoa Arthropoda
Chelicerata Merostomata Xiphosura
Limulidae Limulus. REFERENCE 1 (bases 1 to
3808) AUTHORS Battelle,B.-A., Andrews,A.W.,
Calman,B.G., Sellers,J.R.,
Greenberg,R.M. and Smith,W.C. TITLE A
myosin III from Limulus eyes is a clock-regulated
phosphoprotein JOURNAL J. Neurosci. (1998) In
press REFERENCE 2 (bases 1 to 3808) AUTHORS
Battelle,B.-A., Andrews,A.W., Calman,B.G.,
Sellers,J.R., Greenberg,R.M. and
Smith,W.C. TITLE Direct Submission
JOURNAL Submitted (29-APR-1998) Whitney
Laboratory, University of Florida,
9505 Ocean Shore Blvd., St. Augustine, FL 32086,
USA REFERENCE 3 (bases 1 to 3808) AUTHORS
Battelle,B.-A., Andrews,A.W., Calman,B.G.,
Sellers,J.R., Greenberg,R.M. and
Smith,W.C. TITLE Direct Submission
JOURNAL Submitted (02-MAR-2000) Whitney
Laboratory, University of Florida,
9505 Ocean Shore Blvd., St. Augustine, FL 32086,
USA REMARK Sequence update by
submitter COMMENT On Mar 2, 2000 this
sequence version replaced gi3132700.
Definition Title
NCBIs Taxonomy
39GenBank Record Feature Table
FEATURES Location/Qualifiers
source 1..3808
/organism"Limulus polyphemus"
/db_xref"taxon6850"
/tissue_type"lateral eye" CDS
258..3302 /note"N-terminal
protein kinase domain C-terminal myosin
heavy chain head substrate for PKA"
/codon_start1
/product"myosin III"
/protein_id"AAC16332.2"
/db_xref"GI7144485"
/translation"MEYKCISEHLPFETLPDPGDRFEVQELVGTGTYATV
YSAIDKQA NKKVALKIIGHIAENLLDIET
EYRIYKAVNGIQFFPEFRGAFFKRGERESDNEVWLGI
EFLEEGTAADLLATHRRFGIHLKEDLIALIIKEVVRAVQYLHE
NSIIHRDIRAANIMF
SKEGYVKLIDFGLSASVKNTNGKAQSSVGSPYWMAPEVISCDCLQEPYNY
TCDVWSIG ITAIELADTVPSLSDIHALRAM
FRINRNPPPSVKRETRWSETLKDFISECLVKNPEYR
PCIQEIPQHPFLAQVEGKEDQLRSELVDILKKNPGEKLRNKPYN
VTFKNGHLKTISGQ BASE COUNT 1201 a 689 c
782 g 1136 t ORIGIN 1 tcgacatctg
tggtcgcttt ttttagtaat aaaaaattgt attatgacgt
cctatctgtt 3781 aagatacagt aactagggaa
aaaaaaaa //
40Multiple Formats are available for Sequence Data
- Historically, all the DNA and Protein software
was written concurrent with the establishment of
the databases. So the formats needed in the
databases and the software co-evolved. - Sequence analysis software needs simpler formats
than databases for speed- or else the program
must be allowed to ignore most of the excess
information.
41 FastA format is a very popular solution
gtgi603218gbU18238.1MSU18238 Medicago sativa
glucose-6-phosphate dehyd CCACCAGATATAATTAAGTAGATC
AGAGTAGAAGAAGATGGGAACAAATGAATGGCATGTAGAAAGAAGA GAT
AGCATAGGTACTGAATCTCCTGTAGCAAGAGAGGTACTTGAAACTGGCAC
ACTCTCTATTGTTGTGC TTGGTGCTTCTGGTGATCTTGCCAAGAAGAAG
ACTTTTCCTGCACTTTTTCACTTATATAAACAGGAATT GTTGCCACCTG
ATGAAGTTCACATTTTTGGCTATGCAAGGTCAAAGATCTCCGATGATGAA
TTGAGAAAC AAATTGCGTAGCTATCTTGTTCCAGAGAAAGGTGCTTCTC
CTAAACAGTTAGATGATGTATCAAAGTTTT TACAATTGGTTAAATATGT
AAGTGGCCCTTATGATTCTGAAGATGGATTTCGCTTGTTGGATAAAGAGA
T TTCAGAGCATGAATATTTGAAAAATAGTAAAGAGGGTTCATCTCGGAG
GCTTTTCTATCTTGCACTTCCT CCTTCAGTGTATCCATCCGTTTGCAAG
ATGATCAAAACTTGTTGCATGAATAAATCTGATCTTGGTGGAT GGACAC
GCGTTGTTGTTGAGAAACCCTTTGGTAGGGATCTAGAATCTGCAGAAGAA
CTCAGTACTCAGAT TGGAGAGTTATTTGAAGAACCACAGATTTATCGTA
TTGATCACTATTTAGGAAAGGAACTAGTGCAAAAC ATGTTAGTACTTCG
TTTTGCAAATCGGTTCTTCTTGCCTCTGTGGAACCACAACCACATTGACA
ATGTGC AGATAGTATTTAGAGAGGATTTTGGAACTGATGGTCGTGGTGG
ATATTTTGACCAATATGGAATTATCCG AGATATCATTCCAAACCATCTG
TTGCAGGTTCTTTGCTTGATTGCTATGGAAAAACCCGTTTCTCTCAAG C
CTGAGCACATTCGAGATGAGAAAGTGAAGGTTCTTGAATCAGTACTCCCT
ATTAGAGATGATGAAGTTG TTCTTGGACAATATGAAGGCTATACAGATG
ACCCAACTGTACCGGACGATTCAAACACCCCGACTTTTGC AACTACTAT
TCTGCGGATACACAATGAAAGATGGGAAGGTGTTCCTTTCATTGTGAAAG
CAGGGAAGGCC CTAAATTCTAGGAAGGCAGAGATTCGGGTTCAATTCAA
GGATGTTCCTGGTGACATTTTCAGGAGTAAAA AGCAAGGGAGAAACGAG
TTTGTTATCCGCCTACAACCTTCAGAAGCTATTTACATGAAGCTTACGGT
CAA GCAACCTGGACTGGAAATGTCTGCAGTTCAAAGTGAACTAGACTTG
TCATATGGGCAACGATATCAAGGG ATAACCATTCCAGAGGCTTATGAGC
GTCTAATTCTCGACACAATTAGAGGTGATCAACAACATTTTGTTC GCAG
AGACGAATTAAAGGCATCATGGCAAATATTCACACCACTTTTACACAAAA
TTGATAGAGGGGAGTT GAAGCCGGTTCCTTACAACCCGGGAAGTAGAGG
TCCTGCAGAAGCAGATGAGTTATTAGAAAAAGCTGGA TATGTTCAAACA
CCCGGTTATATATGGATTCCTCCTACCTTATAGAGTGACCAAATTTCATA
ATAAAACA AGGATTAGGATTATCAGGAGCTTATAAATAAGTCTTCAATA
AGCTTGTGAAATTTTCGTTATAATCTCTC TCATTTTGGGGTGTATATCA
AGCATTTAAGCGCGTGTTTGACACAGTTTGTGTAATAGATTTGGCTCTGA
ATGAAAATAAACGGGAATTGTTTCTTTTTGTTTTA
gt
42FASTA format
43Graphics format
44ASN.1 Format
- ASN.1, or Abstract Syntax Notation One, is an
International Standards Organization (ISO) data
representation format used to achieve
interoperability between platforms. - NCBI uses ASN.1 for the storage and retrieval of
data such as nucleotide and protein sequences,
structures, genomes, and MEDLINE records. - ASN.1 permits computers and software systems of
all types to reliably exchange both the data
structure and content.
45NCBI Software Development Tool Kit
- The "NCBI Toolbox" is a set of software and data
exchange specifications used by NCBI to produce
portable, modular software for molecular biology.
- The software in the Toolbox is primarily designed
to read ASN.1 format records. - It is available to the public in the
toolbox/ncbi_tools directory of NCBI's ftp site,
and can be used in its own right or as a
foundation for building tools with similar
properties. - The readme files in the toolbox and
toolbox/ncbi_tools directories of the FTP site
contain more information about the toolbox and
ASN.1.
46Abstract Syntax Notation ASN.1
Seq-entry set level 1 , class nuc-prot
, descr title "Medicago sativa
glucose-6-phosphate dehydrogenase mRNA, and
translated products" , source org
taxname "Medicago sativa subsp. sativa" ,
db db "taxon" ,
tag id 56147 ,
orgname name binomial
genus "Medicago" ,
species "sativa" , subspecies
"subsp. sativa" , mod
47NCBI Toolbox
/
asn2ff.c
convert an ASN.1 entry to flat file format,
using the FFPrintArray.
/ include ltaccentr.hgt include
"asn2ff.h" include "asn2ffp.h" include
"ffprint.h" include ltsubutil.hgt include
ltobjall.hgt include ltobjcode.hgt include
ltlsqfetch.hgt include ltexplore.hgt ifdef
ENABLE_ID1 include ltaccid1.hgt endif FILE
fpl Args myargs "Filename for asn.1
input","stdin",NULL,NULL,TRUE,'a',ARG_FILE_IN,0.0,
0,NULL, "Input is a Seq-entry","F", NULL ,NULL
,TRUE,'e',ARG_BOOLEAN,0.0,0,NULL, "Input
asnfile in binary mode","F",NULL,NULL,TRUE,'b',ARG
_BOOLEAN,0.0,0,NULL, "Output
Filename","stdout", NULL,NULL,TRUE,'o',ARG_FILE_OU
T,0.0,0,NULL, "Show Sequence?","T", NULL ,NULL
,TRUE,'h',ARG_BOOLEAN,0.0,0,NULL,
48Database Tools arent keeping pace
- Despite the huge progress in sequencing and
expression analysis technologies, and the
corresponding magnitude of more data that is held
in the public, private and commercial databases,
the tools used for storage, retrieval, analysis
and dissemination of data in bioinformatics are
still very similar to the original systems
gathered together by researchers 15-20 years ago.
- Many are simple extensions of the original
academic systems, which have served the needs of
both academic and commercial users for many
years. - These systems are now beginning to fall behind
as they struggle to keep up with the pace of
change in the pharma industry.
49Database Tools arent keeping pace
- Databases are still gathered, organized,
disseminated and searched using flat files. - Relational databases are still few and far
between, and object-relational or fully object
oriented systems are rarer still in mainstream
applications. - Interfaces still rely on command lines, fat
client interfaces, which must be installed on
every desktop, or HTML/CGI forms. - Whilst they were in the hands of bioinformatics
specialists, pharmas have been relatively
undemanding of their tools. - Now the problems have expanded to cover the
mainstream discovery process, much more flexible
and scalable solutions are needed to serve pharma
RD informatics requirements.
50There are more than one type of DNA sequence in
Genebank
- Genomic sequences made from genomic DNA- these do
contain introns and LOTS of DNA that never
becomes messenger RNA. mRNA codes for proteins. - cDNA sequences made from mRNA- these dont
contain the introns - ESTS (short stretches of cDNA sequences that are
sort of a rough draft - mtDNA from mitochondrial genomes
- SNP single nucleotide polymorphisms with some DNA
variation.
51Quality of the Sequence is Variable
- Some of the DNA is sequenced several times before
it is added to the databases. - Some of the DNA is sequenced very quickly on
automated equipment and is input directly from
the computers. - Both are important types of information.
- The draft is corrected by curators who assemble
the pieces into the genome.
52Genome Sequencing
Whole BAC insert (or genome)
shredding
sequencing
cloning isolating
GSS division or trace archive
assembly
Draft Sequence (HTG division)
53Working Draft Sequence
54Assembly Required.
- All the data is still in the pieces used to
assemble the genomes. - So, that means all the overlapping pieces are
still in the databases. - So, searching comes up with many versions and
shorter subclones pieces which are used to
assemble the genomic contigs or contiguous
pieces which are assembled into whole
chromosomes. - Sometimes you want to use the smaller pieces,
since handling the whole chromosome is awkward in
sequence analysis.
55HTG Division High Throughput Genome
40,000 to gt 350,000 bp
56HTG Division High Throughput Genome
40,000 to gt 350,000 bp
57Whole Genome Shotgun
58STS Division Sequence Tagged Sites
- Segment of gene, EST , mRNA or genomic DNA
- of known position (microsatellite)
- PCR with STS primers gives one product per genome
- Basis of Radiation Hybrid Mapping
- UniGene
- Genome Assembly
- Related resource Electronic PCR
- http//www.ncbi.nlm.nih.gov/genome/sts/epcr.c
gi
59Be aware of errors in the databases
- Sequence errors
- genome projects error rate is 1/10,000
nucleotides - ESTs error rate is 1/100 nucleotides.
- Annotation errors
- Many databases annotate their sequences using
automated computer programs. These programs do
not always give correct annotations. - SwissProt is a protein database curated and
annotated manually by biologists. Its regarded
as the most reliable database, but does not have
the most up-to-date sequence information.
60There is a Lot of Sequence in the Databases
- One problem is finding what you are looking for
in the database. - Try putting in the search term human beta
hemoglobin into the nucleotide database. It
wont be easy to find the sequence in the 88
pages of hits! - RefSeq was invented to help you find some of the
common sequences based on a human (or now, a
computer) looking over all the similar
submissions of the same sequence to the database. - RefSeq corrects some of those sequence errors by
comparing lots of sequences.
61RefSeq NCBIs Derivative Sequence Database
- Curated transcripts and proteins
- reviewed
- human, mouse, rat, fruit fly, zebrafish,
arabidopsis, C. elegans - Human model transcripts and proteins
- Assembled Genomic Regions (contigs)
- draft human genome
- mouse genome
- Chromosome records
- microbial
- organelle
62RefSeq Benefits
- non-redundancy
- explicitly linked nucleotide and protein
sequences - updates to reflect current sequence data and
biology - data validation
- format consistency
- distinct accession series
- stewardship by NCBI staff and collaborators
63The RefSeq Accession Numbers
NCBI Reference Sequences mRNAs and
Proteins NM_123456 Curated mRNA NP_123456 Curated
Protein NR_123456 Curated non-coding
RNA XM_123456 Predicted Transcript (human,
mouse) XP_123456 Predicted Protein (human,
mouse) XR_123456 Predicted non-coding RNA Gene
Records NG_123456 Reference Genomic Sequence
(human) Assemblies NT_123456 Contig (Mouse and
Human) NW_123456 WGS Supercontig
(Mouse) NC_123455 Chromosome (Microbial,
Arabidopsis )
64GenBank Sequences Human Lipoprotein Lipase
65Curated RefSeq Records NM_, NP_
66Alignment Based Models
67Alignment Based Models
68Alignment GeneratedTranscripts XM_,XP_
69RefSeq Contig NT_, NW_
70RefSeq Chromosomes NC_
LOCUS NC_002695 5498450 bp DNA
circular BCT 02-OCT-2001 DEFINITION
Escherichia coli O157H7, complete
genome. ACCESSION NC_002695 VERSION
NC_002695.1 GI15829254 KEYWORDS . SOURCE
Escherichia coli O157H7. ORGANISM
Escherichia coli O157H7 Bacteria
Proteobacteria gamma subdivision
Enterobacteriaceae
Escherichia. REFERENCE 1 (sites) AUTHORS
Makino,K., Yokoyama,K., Kubota,Y., Yutsudo,C.H.,
Kimura,S., Kurokawa,K., Ishii,K.,
Hattori,M., Tatsuno,I., Abe,H., Iida,T.,
Yamamoto,K., Ohnishi,M., Hayashi,T.,
Yasunaga,T., Honda,T., Sasakawa,C.
and Shinagawa,H. TITLE Complete nucleotide
sequence of the prophage VT2-Sakai carrying the
verotoxin 2 genes of the
enterohemorrhagic Escherichia coli O157H7
derived from the Sakai outbreak JOURNAL
Genes Genet. Syst. 74 (5), 227-239 (1999)
MEDLINE 20198780 PUBMED 10734605
71Integrated WWW Access BLAST and Entrez
72Some Web Statistics
July 2001
73Users per day
1997 1998 1999 2000
2001
74Bulk GenBank Divisions
- Batch Submission and htg (email and ftp)
- Inaccurate
- Poorly Characterized
EST Expressed Sequence Tag STS Sequence Tagged
Site GSS Genome Survey Sequence HTG High
Throughput Genomic
75EST Division Expressed Sequence Tags
gtIMAGE275615 5' mRNA sequence GACAGCATTCGGGCCGAGA
TGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTCTGGC
C TGGAGGTATCCAGCGTACTCCAAAGATTCAGGTTTACTCACGTCATCC
AGCAGAGAATGGAAAGTCAAAT TTCCTGAATTGCTATGTGTCTGGGTTT
CATCCATCCGACATTGAAGTTGACTTACTGAAGAATGGAGAGA GAATTG
AAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTAT
CTCTTGTACTACAC TGAATTCACCCCCACTGAAAAAGATGAGTATGCCT
GCCGTGTTGAACCATGTNGACTTTGTCACAGNCCC AAGTTNAGTTTAAG
TGGGNATCGAGACATGTAAGGCAGGCATCATGGGAGGTTTTGAAGNATGC
CGCNTT TTGGATTGGGATGAATTCCAAATTTCTGGTTTGCTTGNTTTTT
TAATATTGGATATGCTTTTG
nucleus 30,000 genes
gatccantgccatacg
ctcgccaattcnntcg
gtIMAGE275615 3', mRNA sequence NNTCAAGTTTTATGATTT
ATTTAACTTGTGGAACAAAAATAAACCAGATTAACCACAACCATGCCTTA
CT TTATCAAATGTATAAGANGTAAATATGAATCTTATATGACAAAATGT
TTCATTCATTATAACAAATTTCC AATAATCCTGTCAATNATATTTCTAA
ATTTTCCCCCAAATTCTAAGCAGAGTATGTAAATTGGAAGTTAA CTTAT
GCACGCTTAACTATCTTAACAAGCTTTGAGTGCAAGAGATTGANGAGTTC
AAATCTGACCAAGAT GTTGATGTTGGATAAGAGAATTCTCTGCTCCCCA
CCTCTANGTTGCCAGCCCTC
- - isolate unique clones
- sequence once
- from each end
RNA gene products
76Unigene
- A gene-oriented view of sequence entries
- UniGene collects expressed sequence tags (ESTs)
into clusters, in an attempt to form one gene per
cluster. - Use UniGene to study where your gene is expressed
in the body, when it is expressed, and see its
abundance.
77UniGene
- MegaBlast based automated sequence clustering
- Nonredundant set of gene oriented clusters
- Each cluster a unique gene
- Information on tissue types and map locations
- Includes well-characterized genes and novel ESTs
- Useful for gene discovery and selection of
mapping reagents
http//www.ncbi.nlm.nih.gov/UniGene/
78EST hits A.t. serine protease mRNA
A.t. mRNA
5 EST hits
3 EST hits
79Arabidopsis UniGene Statistics
39,855 mRNAs gene CDSs 87,006
EST, 3'reads 42,137 EST, 5'reads
32,571 EST, other/unknown ----------
201,569 total sequences in clusters Final
Number of Clusters (sets)
sets total 25,474 sets
contain at least one known gene 17,654 sets
contain at least one EST 16,326 sets contain
both genes and ESTs
UniGene Build 14 Apr. 9th, 2002
26,808
115,000,000 bp 25,498 expected genes 5
uncharacterized transcripts
80Hs UniGene Statistics
73,419 mRNAs gene CDSs 1,181,855
EST, 3'reads 1,461,928 EST, 5'reads
616,609 EST, other/unknown ----------
3,333,811 total sequences in clusters Final
Number of Clusters (sets)
sets total 22,431 sets
contain at least one known gene 97,618 sets
contain at least one EST 21,233 sets contain
both genes and ESTs
UniGene Build 148 Apr. 8th, 2002
98,816
3,000,000 base pairs 30 K expected genes 80
uncharacterized transcripts
81UniGene Collections Jul, 2002
Sequences Clusters Homo sapiens human
3,569,546 101,602 Mus musculus mouse
2,332, 864 84,247 Rattus norvegicus rat
334,582 62,220 Danio rerio zebrafish
197,266 15,404 Bos taurus cow 128,914
10,295 Xenopus laevis frog 162,269
18,984 D.melanogaster fruit fly
250,655 11, 115 Anopholes gambiae mosquito
43,126 2,556 Plants Arabidopsis
thaliana thale cress 210,693 26,875 Oryzia
sativa rice 78,632 15,802 Triticum
aestivum wheat 139,447 12,575 Hordeum
vulgare barley 160,518 7,324 Zea
mays maize (corn) 131,668 10,301