Title: Macromolecular Crystallization N' Sukumar NECAT, Building 436 Argonne National Lab Argonne, Illinois
1Macromolecular CrystallizationN.
SukumarNE-CAT, Building 436Argonne National Lab
Argonne, Illinois
2Crystallization
- Crystals Purified protein undergoes slow
precipitation from an aqueous solution, resulted
in alignment of protein molecules in a repeating
series of unit cell by adopting consistent
orientation. The molecules are held together by
non-covalent interactions. - May Call this Black Art then a Science.
Because, some people will get the crystals, while
others can not reproduce the crystals exactly at
the same condition. - Now, the process is more understood than 1980s
but still far away from understanding the
mechanism behind the crystallization. - Major Bottleneck in the structure determination
of macromolecules.
3Pre-crystallization necessities
- Pure protein gt 95 (at least gt 90) (In
SDS-PAGE) -
- Use Dynamic Light Scattering (DLS) and Mass
Spectroscopy to study the homogeneity and
stability problems of the sample - Concentration of protein gt5mg/ml. At least, a
concentration , where precipitation occurs 35
of times during initial screening. - Proteins can be stored at -70C. Split the
samples in small aliquots to avoid repeated
freezing and thawing.
4Theory of Crystallization
5Types of crystallization setup
- Frequently used techniques
- - Sitting drop and hanging drop methods
- Sparingly used techniques
- - Free Interface Diffusion (FID)
- - Sandwich Drop,
- - Batch, Microbatch (with and w/o oil)
- - Microdialysis
6Hanging drop and Sitting drop method
- The protein is mixed with a crystallization
solution containing various precipitants.
(usually 2µl and 2µl) (called the drop) - The diluted protein and crystallization mixture
is incubated over the concentrated
crystallizationsolution (called the well). - Over time, the drop will equilibrate with the
well concentrating both the protein and the
precipitants. - As the protein concentrates it can come out of
solution as either a precipitate, a phase
transition (oil), or as a crystal.
7Free Interface Diffusion (FID)
8Sandwich Drop
9Batch method
10Microbatch Under Oil
11Microdialysis
12Theory of Crystallization(Chayen, Cur. Op. Str.
Bio. 14, 577-583 (2004)
13Well Solution
- Buffers (either non-zwitterionic or zwitterionic)
of concentration 100mM in the pH range 4-9. - 2. Salts which includes monovalent, divalent
salts - in wide range of concentration - 3, Precipitants
- Poly Ethylene Glycols (PEG) of different
molecular weight -
- Salts (Ammonium Sulfate , LiSo4, LiCl, Na
Formate, Na Citrate) - Ethanol, MPD, iso-propanol
14Commercial Screens
- Hampton Research (HR) www.hamptonresearch.com
- Emerald BioSystems www.emeraldbiosystems.com
- Sigma-Aldrich Screens www.sigma-aldrich.com/x
raycrystallography - Each screen usually contains 24-50 solutions
- All the companies produce variety of specialty
screens such as Membrane protein kit, CRYO
(conditions ready for freezing), MPD etc. - - For every new protein, start with at least
HRs Crystal Screen I II and - Index Screen.
15How to analyze the drops?
16How to analyze the drops?
- Drop - Clear, Light, Medium or Heavy
precipitate - Note whether precipitate is always in a
certain type of condition like gtpH 7, PEGS,
specific salts etc. - - microcrystals, Phase separation, salt
crystals - Microcrystalline or phase separation
- Good starting point - large crystals can
be obtained by varying protein concentration and
various components present in the well . - Sometimes it might be difficult to distinguish
micro-crystals from precipitate.
17Good Crystals
18Quality of good crystals
- Single (not attached to others, grown in
cluster etc. this might be fine, or might be
evidence of problems) - - When you pick a crystal from a cluster,
but should be very careful during the process. - Straight edges.Curves are generally bad
- Reasonable size, 100-400 microns
- But, not all the good looking crystals will
diffract well. Reason nobody can tell
19What to do when there is a hit
- For example, there is a very small or micro-
crystals or phase separation at - 20PEG 4000, 200mM NaCl, 100mM Tris-HCl
Buffer pH 7.5 - 1. While scanning around the condition,
vary only one parameter at a time - 2. Scan the concentration of PEG4K in the
range 0 - 40 - 3. Scan PEG 3000, PEG 3500, PEG 5000 PEG
6000 in the same concentration range. Usually,
higher mol. wt. PEG less concentration - and vice versa.
- 4. Scan NaCl concentration in the range
from 0- 400mM - 5. Scan with different monovalent salts
like ammonium chloride, lithium chloride,
potaasium chloride etc. -
20What to do when there is a hit
- 6. Scan with salt like Na Formate, Na
sulfate, Na acetate etc. -
- 7 . Before choosing the salts, check again
your screen result whether any of - the salts presence always leads to
precipitation or not. - 8. check the whole buffer active range with
D0.2. - 9. Change the buffer suitable in that range
and scan it. - 10. Check everything you can think of.
- 11. Once stable conditions found and
reproducible, then try Additives. - 12. Try Seedings
-
21Additives
- Additives additional chemical added in small
amount to modify the crystallization conditions - Sugars (like Xylitol, Sorbital etc), Salts, MPD,
Ethyene Glycol can be used as an additive. - Hampton Research sells additive screen (96
tubes). - Added only to the drop.
- Adding 10mM of any of the additives to the drop
is a good start.
22Procedure for Macroseeding
23Procedure for microseeding
24Procedure for Streak Seeding
25What to do when there is no hit
- Evaluate the Screen carefully.
- What pHs are soluble, preferred salts
- Does your protein need more salt/glycerol to
remainstable? - Crystallize in the presence of substrates,
inhibitors. - - try multiple substrates at a time
adding substrates - or inhibitors can stabilize the
conformation of protein - Change the stabilization buffer
26What to do when there is no hit
- Did you really check the purity thoroughly
before? - - Try site directed mutagenesis - Mutating
Asn to Asp will increase solubility - - Change hydrophobic residues to
hydrophilic residues especially surface - residues of the protein
- - remove if any biologically insignificant
portion present at the N-terminal or C-terminal
of the protein - - Try different constructs
- - With or without Tags
- - Change the source
27Examples
28TdT (Terminal deoxynucleotidyl transferase)-
belongs to family of DNA polymerase ß (pol ß)
family (Sukumar et al. Acta Cryst., D56,
1662-1664 (2000)
- Contains two functionally independent region.
N-terminal domain (130 aa) and C-terminal domain
(399 aa). Crystallizing full length protein was
difficult. - Chopping off N-terminal domain gave the crystals
in 24 hours (i.e. C-terminal domain which
contains catalytic core of the protein).
29Amicyanin crystal grown by macroseeding in 6
months time- size 2x1.3x1mm (Ref. Sukumar et al,
Acta Cryst. D61, 640-642 (2005)
30Macroseeding Unknown spoiling factor(s)
involved
31Membrane protein crystallization
- Membrane proteins represent close to 40 of
currently sequenced genomes. - Currently, PDB contain 31721 entries.
- Only 170 PDB entries are accounted for membrane
proteins (just 0.5) Out of 170 entries, only
93 are unique proteins.
32Membrane protein Crystallization
- Difficult to handle because of amphipathic
nature. Possess hydrophobic surface where they
in contact with lipid bilayers and polar surface
where they in contact with aqueous solution as
well as polar head group of lipids. - To solubilize and purify membrane proteins,
detergents required amphiphilic molecules that
form micelles above their critical miceller
concentration (CMC). - Various detergents (like Triton, C8E4, Octyl
Glucoside etc) need to be scanned for
purification. - Figure shows monotopic membrane protein binds to
the membrane
33Membrane Protein Crystallization
- Getting large quantity of pure protein necessary
for crystallization is a problem. - Needs detergent to get crystallized in addition
to all the components discussed before for
globular proteins. - Finding right detergent is a major problem
- Even the good crystals may not give good
diffraction. Such situation arises more
frequently in membrane protein than soluble
proteins.
34Example Monotopic membrane protein - Mandelate
Dehydrogenase (MDH)
- MDH - Got crystals with at least three different
detergents. - Improved diffraction from 12? to 3.7?.
- As the diffraction could not be improved beyond
3.7?, alternate approach was tried.
35MDH Vs GOX (Glycolate Oxidase) sequence
- WT MDH MSQNLFNVEDYRKLAQKRLPKMVYDYLEGGAEDEYGV
KHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPT
80 - WT GOX MEIT--NVNEYEAIAKQKLPKMVYDYYASGAEDQWTL
AENRNAFSRILFRPRILIDVTNIDMTTTILGFKISMPIMIAPT
78 - WT MDH GLNGALWPKGDLALARAATKAGIPFVLSTASNMSIED
LARQCDGDLWFQLYV-IHREIAQGMVLKALHTGYTTLVLTTDV
159 - WT GOX AMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEE
VASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDT
158 -
- WT MDH AVNGYRERDLHNRFKIPMSYSAKVVLDGCLHPRWSLD
FVRHGMPQLANFVSSQTSSLEMQAALMSRQMDASFNWEALRWL
239 - WT GOX PRLGRREADIKNRFVLPPFLTLKNFEGI---------
----------DLGKMDKANDSGLSSYVAGQIDRSLSWKDVAWL
219 -
- WT MDH RDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGG
RQLDCAISPMEVLAQSV-AKTGK-PVLIDSGFRRGSDIVKALA
317 - WT GOX QTITSLPILVKGVITAEDARLAVQHGAAGIIVSNHGA
RQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALA
299 - WT MDH LGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDR
TLAQIGCPDITSLSPDYLQNE-GVTNTAPVDHLIGKGTHA 393 - WT GOX LGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFEL
TMALSGCRSLKEISRSHIAADWDGPSSRAVARL 369
36MDH-GOX2 crystal
- Crystallized in sitting drop method Drop
Protein MESAmm. Sulfate Et.Glycol and FMN - Reservoir solution 4M NaCl
- Diffracted to 1.35? resolution
- For the first time, an intrachain
membrane-binding segment is replaced with its
soluble homologue to facilitate crystallization,
but still retains catalytic activity.
37Chimera of Mandelate Dehydrogenase (MDH-GOX2)
GOX (Ref. Sukumar et al, Biochemistry, 40,
9870-9878 (2001)
- GOX insert in MDH closely similar to
corresponding segment in GOX. - In GOX, 189-195 residues is disordered.
- 198-206 in MDH (its own residues) which is
a-helical as predicted but different from
corresponding segment of GOX(198-205) by 100. - MDH-GOX2 (Blue) and GOX (Red). Poorly conserved
segments of MDH-GOX2 and GOX are in Yellow and
Green respectively.
38MDH-GOX2 crystal
- Once you get crystals and collect good data, rest
of your project will be around the computers. - Sometime, you may need to come back to wet lab
for crystallization.. When?? - MDH-GOX2 is one such example. The crystals are
twinned. Though there are many powerful programs
are available at present, it is always better to
remove twinning if possible. -
- In this case of MDH-GOX2, twinning removed by
cutting the crystals along the crack, into two
equal halves. - In one of its mutants, twinning removed by adding
substrate to it.
39References
- Crystallization of Biological Macromolecules A.
Mcpherson, Cold Spring Harbor Laboratory press
(ISBN 0-87969-527-7) - Methods and Results in Crystallization of
Membrane proteins Ed. So Iwata, IUL
Biotechmology Series (ISBN No. 0-9636817-9-6) - Methods in Enzymology, Vol 276, Part A (ISBN
0-12-182177-3) and Vol 368 Part C (ISBN
0-12-182177-3) Eds. C.W. Carter, Jr R.M.
Sweet, Academic Press - International Tables of Crystallography Vol. F
Eds. M.G. Rossmann and E.Arnold (ISBN
0-7923-6857-6) - www.hamptonresearch.com
- http//wwwstructure.llnl.gov/crystal_lab/crystall.
htm - http//www.biochem.utah.edu/heidi/crystallization
.htm - http//photoscience.la.asu.edu/photosyn/faculty/Al
len/protein-structures/membrane-proteins/crystal.h
tml